Fusobacterium nucleatum (Fn), a commensal in the human oral cavity, is overrepresented in the colon microbiota of colorectal cancer (CRC) patients and is linked to tumor chemoresistance, metastasis, and a poor therapeutic prognosis. Fn produces numerous adhesins that mediate tumor colonization and downregulation of the host’s antitumor immune response. One of these, the trimeric autotransporter adhesin (TAA) CEACAM binding protein of Fusobacterium (CbpF), targets CEACAM1 on T-cells and has been associated with immune evasion of Fn-colonized tumors. Whereas the role of CEACAM1 in homophilic and heterophilic cell interactions and immune evasion is well described, the mechanistic details of its interaction with fusobacterial CbpF remain unknown due to the lack of a high-resolution structure of the adhesin–receptor complex. Here, we present two structures of CbpF alone and in complex with CEACAM1, obtained by cryogenic electron microscopy and single particle analysis. They reveal that CbpF forms a stable homotrimeric complex whose N-terminal part of the extracellular domain comprises a 64 Å long β roll domain with a unique lateral loop extension. CEACAM1 binds to this loop with high affinity via its N-terminal IgV-like domain with a nanomolar dissociation constant as determined by surface plasmon resonance. This study provides a comprehensive structural description of a fusobacterial TAA, illustrates a yet undescribed CEACAM1 binding mode, and paves the way for rational drug design targeting Fn in CRC.

Anti-contactin associated protein receptor 2 (CASPR2) encephalitis is a severe autoimmune encephalitis with a variable clinical phenotype including behavioral abnormalities, cognitive decline, epileptic seizures, peripheral nerve hyperexcitability and neuropathic pain. The detailed mechanisms of how CASPR2 autoantibodies lead to synaptic dysfunction and clinical symptoms are largely unknown. Aiming for analyses from the molecular to the clinical level, we isolated antibody-secreting cells from the cerebrospinal fluid of two patients with CASPR2 encephalitis. From these we cloned four anti-CASPR2 human monoclonal autoantibodies (mAbs) with strong binding to brain and peripheral nerves. All were highly hypermutated and mainly of the IgG4 subclass. Mutagenesis studies determined selective binding to the discoidin domain of CASPR2. Surface plasmon resonance revealed affinities with dissociation constants KD in the pico- to nanomolar range. CASPR2 mAbs interrupted the interaction of CASPR2 with its binding partner contactin 2 in vitro and were internalized after binding to CASPR2-expressing cells. Electrophysiological recordings of rat hippocampal slices after stereotactic injection of CASPR2 mAbs showed characteristic afterpotentials following electrical stimulation. In vivo experiments with intracerebroventricular administration of human CASPR2 mAbs into mice and rats showed EEG-recorded brain hyperexcitability but no spontaneous recurrent seizures. Behavioral assessment of infused mice showed a subtle clinical phenotype, mainly affecting sociability. Mouse brain MRI exhibited markedly reduced resting-state functional connectivity without short-term structural changes. Together, the experimental data support the direct pathogenicity of CASPR2 autoantibodies. The minimally invasive EEG and MRI techniques applied here may serve as novel objective, quantifiable tools for improved animal models, in particular for subtle neuropsychiatric phenotypes or repeated measurements.

Eps15 (epidermal growth factor receptor pathway substrate 15) homology domain-containing proteins (EHDs) comprise a family of eukaryotic dynamin-related ATPases that participate in various endocytic membrane trafficking pathways. Dysregulation of EHDs function has been implicated in various diseases, including cancer. The lack of small molecule inhibitors which acutely target individual EHD members has hampered progress in dissecting their detailed cellular membrane trafficking pathways and their function during disease. Here, we established a Malachite green-based assay compatible with high throughput screening to monitor the liposome-stimulated ATPase of EHD4. In this way, we identified a drug-like molecule that inhibited EHD4’s liposome-stimulated ATPase activity. Structure activity relationship (SAR) studies indicated sites of preferred substitutions for more potent inhibitor synthesis. Moreover, the assay optimization in this work can be applied to other dynamin family members showing a weak and liposome-dependent nucleotide hydrolysis activity.

Tryptophan hydroxylases catalyze the first and rate-limiting step in the biosynthesis of serotonin, a well-known neurotransmitter that plays an important role in multiple physiological functions. A reduction of serotonin levels, especially in the brain, can cause dysregulation leading to depression or insomnia. In contrast, overproduction of peripheral serotonin is associated with symptoms like carcinoid syndrome and pulmonary arterial hypertension. Recently, we developed a class of TPH inhibitors based on xanthine-benzimidazoles, characterized by a tripartite-binding mode spanning the binding sites of the cosubstrate pterin and the substrate tryptophan and by chelation of the catalytic iron ion. Herein, we describe the structure-based development of a second generation of xanthine-imidiazopyridines and -imidazothiazoles designed to inhibit TPH1 in the periphery while preventing the interaction with TPH2 in the brain. Lead compound 32 (TPT-004) shows superior pharmacokinetic and pharmacodynamic properties as well as efficacy in preclinical models of peripheral serotonin attenuation and colorectal tumor growth.

Uridine diphosphate N-acetylglucosamine 2-epimerase (GNE) is a key enzyme in the sialic acid biosynthesis pathway. Sialic acids are primarily terminal carbohydrates on glycans and play fundamental roles in health and disease. In search of effective GNE inhibitors not based on a carbohydrate scaffold, we performed a high-throughput screening campaign of 68,640 drug-like small molecules against recombinant GNE using a UDP detection assay. We validated nine of the primary actives with an orthogonal real-time NMR assay and verified their IC50 values in the low micromolar to nanomolar range manually. Stability and solubility studies revealed three compounds for further evaluation. Thermal shift assays, analytical size exclusion and interferometric scattering microscopy demonstrated that the GNE inhibitors acted on the oligomeric state of the protein. Finally, hydrogen-deuterium exchange mass spectrometry (HDX-MS) revealed which sections of GNE were shifted upon the addition of the inhibitors. In summary, we have identified three small molecules as GNE inhibitors with high potency in vitro, which serve as promising candidates to modulate sialic acid biosynthesis in more complex systems.

A-kinase anchoring proteins (AKAPs) are a family of multivalent scaffolding proteins. They engage in direct protein-protein interactions with protein kinases, kinase substrates and further signaling molecules. Each AKAP interacts with a specific set of protein interaction partners and such sets can vary between different cellular compartments and cells. Thus, AKAPs can coordinate signal transduction processes spatially and temporally in defined cellular environments. AKAP-dependent protein-protein interactions are involved in a plethora of physiological processes, including processes in the cardiovascular, nervous, and immune system. Dysregulation of AKAPs and their interactions is associated with or causes widespread diseases, for example, cardiac diseases such as heart failure. However, there are profound shortcomings in understanding functions of specific AKAP-dependent protein-protein interactions. In part, this is due to the lack of agents for specifically targeting defined protein-protein interactions. Peptidic and non-peptidic inhibitors are invaluable molecular tools for elucidating the functions of AKAP-dependent protein-protein interactions. In addition, such interaction disruptors may pave the way to new concepts for the treatment of diseases where AKAP-dependent protein-protein interactions constitute potential drug targets.Here we describe screening approaches for the identification of small molecule disruptors of AKAP-dependent protein-protein interactions. Examples include interactions of AKAP18 and protein kinase A (PKA) and of AKAP-Lbc and RhoA. We discuss a homogenous time-resolved fluorescence (HTRF) and an AlphaScreen® assay for small molecule library screening and human induced pluripotent stem cell-derived cardiac myocytes (hiPSC-CMs) as a cell system for the characterization of identified hits.

The cAMP-dependent aquaporin-2 (AQP2) redistribution from intracellular vesicles into the plasma membrane of renal collecting duct principal cells induces water reabsorption and fine-tunes body water homeostasis. However, the mechanisms controlling the localization of AQP2 are not understood in detail. Using immortalized mouse medullary collecting duct (MCD4) and primary rat inner medullary collecting duct (IMCD) cells as model systems, we here discovered a key regulatory role of Aurora kinase A (AURKA) in the control of AQP2. The AURKA-selective inhibitor Aurora-A inhibitor I and novel derivatives as well as a structurally different inhibitor, Alisertib, prevented the cAMP-induced redistribution of AQP2. Aurora-A inhibitor I led to a depolymerization of actin stress fibers, which serve as tracks for the translocation of AQP2-bearing vesicles to the plasma membrane. The phosphorylation of cofilin-1 (CFL1) inactivates the actin-depolymerizing function of CFL1. Aurora-A inhibitor I decreased the CFL1 phosphorylation, accounting for the removal of the actin stress fibers and the inhibition of the redistribution of AQP2. Surprisingly, Alisertib caused an increase in actin stress fibers and did not affect CFL1 phosphorylation, indicating that AURKA exerts its control over AQP2 through different mechanisms. An involvement of AURKA and CFL1 in the control of the localization of AQP2 was hitherto unknown.

Fluorine (19F) magnetic resonance imaging (MRI) is severely limited by a low signal-to noise ratio (SNR), and tapping it for 19F drug detection in vivo still poses a significant challenge. However, it bears the potential for label-free theranostic imaging. Recently, we detected the fluorinated dihydroorotate dehydrogenase (DHODH) inhibitor teriflunomide (TF) noninvasively in an animal model of multiple sclerosis (MS) using 19F MR spectroscopy (MRS). In the present study, we probed distinct modifications to the CF3 group of TF to improve its SNR. This revealed SF5 as a superior alternative to the CF3 group. The value of the SF5 bioisostere as a 19F MRI reporter group within a biological or pharmacological context is by far underexplored. Here, we compared the biological and pharmacological activities of different TF derivatives and their 19F MR properties (chemical shift and relaxation times). The 19F MR SNR efficiency of three MRI methods revealed that SF5-substituted TF has the highest 19F MR SNR efficiency in combination with an ultrashort echo-time (UTE) MRI method. Chemical modifications did not reduce pharmacological or biological activity as shown in the in vitro dihydroorotate dehydrogenase enzyme and T cell proliferation assays. Instead, SF5-substituted TF showed an improved capacity to inhibit T cell proliferation, indicating better anti-inflammatory activity and its suitability as a viable bioisostere in this context. This study proposes SF5 as a novel superior 19F MR reporter group for the MS drug teriflunomide.

The mitogen-activated protein kinase kinase 4 (MKK4) plays a key role in liver regeneration and is under investigation as a target for stimulating hepatocytes to increased proliferation. Therefore, new small molecules inhibiting MKK4 may represent a promising approach for treating acute and chronic liver diseases. Fluorescently labeled compounds are useful tools for high-throughput screenings of large compound libraries. Here we utilized the azaindole-based scaffold of FDA-approved BRAF inhibitor vemurafenib 1, which displays off-target activity on MKK4, as a starting point in our fluorescent compound design. Chemical variation of the scaffold and optimization led to a selection of fluorescent 5-TAMRA derivatives which possess high binding affinities on MKK4. Compound 45 represents a suitable tool compound for Fluorescence polarization assays to identify new small-molecule inhibitors of MKK4.

In this paper, we introduce vinylphosphonites for chemoselective Staudinger-phosphonite reactions (SPhR) with azides to form vinylphosphonamidates for the subsequent modification of cysteine residues in peptides and proteins. An electron-rich alkene is turned into an electron-deficient vinylphosphonamidate, thereby inducing electrophilic reactivity for a following thiol addition. We show that by varying the phosphonamidate ester substituent we can fine-tune the reactivity of the thiol addition and even control the functional properties of the final conjugate. Furthermore, we observed a drastic increase in thiol addition efficiency when the SPhR is carried out in the presence of a thiol substrate in a one-pot reaction. Hence, we utilize vinylphosphonites for the chemoselective intramolecular cyclization of peptides carrying an azide-containing amino acid and a cysteine in high yields. Our concept was demonstrated for the stapling of a cell-permeable peptidic inhibitor for protein-protein interaction (PPI) between BCL9 and beta-catenin, which is known to create a transcription factor complex playing a role in embryonic development and cancer origin, and for macrocyclization of cell-penetrating peptides (CPPs) to enhance the cellular uptake of proteins.

Stimulation of renal collecting duct principal cells with antidiuretic hormone (arginine-vasopressin, AVP) results in inhibition of the small GTPase RhoA and the enrichment of the water channel aquaporin-2 (AQP2) in the plasma membrane. The membrane insertion facilitates water reabsorption from primary urine and fine-tuning of body water homeostasis. Rho guanine nucleotide exchange factors (GEFs) interact with RhoA, catalyze the exchange of GDP for GTP and thereby activate the GTPase. However, GEFs involved in the control of AQP2 in renal principal cells are unknown. The A-kinase anchoring protein, AKAP-Lbc, possesses GEF activity, specifically activates RhoA, and is expressed in primary renal inner medullary collecting duct principal (IMCD) cells. Through screening of 18,431 small molecules and synthesis of a focused library around one of the hits, we identified an inhibitor of the interaction of AKAP-Lbc and RhoA. This molecule, Scaff10-8, bound to RhoA, inhibited the AKAP-Lbc-mediated RhoA activation but did not interfere with RhoA activation through other GEFs or activities of other members of the Rho family of small GTPases, Rac1 and Cdc42. Scaff10-8 promoted the redistribution of AQP2 from intracellular vesicles to the periphery of IMCD cells. Thus, our data demonstrate an involvement of AKAP-Lbc-mediated RhoA activation in the control of AQP2 trafficking.

N-Acetylmannosamine kinase (MNK) plays a key role in the biosynthesis of sialic acids and glycosylation of proteins. Sialylated glycoconjugates affect a large number of biological processes, including immune modulation and cancer transformation. In search of effective inhibitors of MNK we applied high-throughput screening of drug-like small molecules. By applying different orthogonal assays for their validation we identified four potential MNK-specific inhibitors with IC50 values in the low-micromolar range. Molecular modelling of the inhibitors into the active site of MNK supports their binding to the sugar or the ATP-binding pocket of the enzyme or both. These compounds are promising for downregulation of the sialic acid content of glycoconjugates and for studying the functional contribution of sialic acids to disease development.

A good fit: Interactions between A-kinase anchoring proteins (AKAPs) and protein kinase A (PKA) play key roles in a plethora of physiologically relevant processes whose dysregulation causes or is associated with diseases such as heart failure. Terpyridines have been developed as α-helix mimetics for the inhibition of such interactions and are the first biologically active, nonpeptidic compounds that block the AKAP binding site of PKA.

Gut eingepasst: Wechselwirkungen zwischen A-Kinase-Ankerproteinen (AKAP) und der Proteinkinase A (PKA) spielen eine entscheidende Rolle bei vielen physiologisch relevanten Prozessen, deren Fehlregulation Krankheiten verursacht oder mit ihnen in Zusammenhang steht (z. B. Herzinsuffizienz). Terpyridine wurden als α-Helixmimetika zur Hemmung solcher Wechselwirkungen entwickelt, die als erste nichtpeptidische Verbindungen die AKAP-Bindungsstelle der PKA blockieren können. Proteinkinase A (PKA) ist eine ubiquitär exprimierte Kinase, die eine Vielzahl von Substraten phosphoryliert. A-Kinase-Ankerproteine (AKAP) erhöhen die Spezifität PKA-abhängiger Signaltransduktion indem sie die PKA an unterschiedlichen zellulären Kompartimenten positionieren und dadurch einen Zugang zu definierten Substraten ermöglichen.1 Die Wechselwirkungen zwischen AKAP und PKA spielen eine Schlüsselrolle bei zahlreichen physiologisch relevanten Prozessen, z. B. bei der Arginin-Vasopressin(AVP)-vermittelten Wasserrückresorption in renalen Hauptzellen; AVP stimuliert die Aktivierung von PKA, das den Wasserkanal Aquaporin-2 (AQP2) phosphoryliert. Dadurch wird das in intrazellulären Vesikeln lokalisierte AQP2 in die Plasmamembran umverteilt und die Rückresorption von Wasser aus dem primären Urin ermöglicht. Die Umverteilung findet nur bei direkter Wechselwirkung der PKA mit AKAP statt.2 Fehlregulationen von zellulären Prozessen, die auf AKAP-PKA-Wechselwirkungen beruhen, verursachen Krankheiten oder werden mit ihnen in Verbindung gebracht.1b, 3 Der bei Herzinsuffizienz erhöhte AVP-Spiegel bewirkt z. B. eine exzessive Wasserretention aufgrund des oben beschriebenen Mechanismus. Bei der Herzinsuffizienz ist die Kontraktilität der Kardiomyozyten vermindert; die Steuerung der Kontraktilität hängt wesentlich von AKAP-PKA-Wechselwirkungen ab.4 Das PKA-Holoenzym ist ein Tetramer, bestehend aus einem Dimer regulatorischer (RIα, RIβ, RIIα oder RIIβ) und zwei katalytischen (C-) Untereinheiten, die jeweils an ein R-Protomer gebunden sind. Durch die Bindung von cAMP an die R-Untereinheiten werden die C-Untereinheiten freigesetzt und können ihre Substrate phosphorylieren. Die Wechselwirkung zwischen PKA und AKAP wird durch die Dimerisierungs/Docking(D/D)-Domäne der dimerisierten R-Untereinheiten und der RII-Bindungsdomäne (RBD) von AKAP vermittelt. Dimerisierte D/D-Domänen bilden eine hydrophobe Tasche, die direkt mit einer 14–25 Aminosäuren langen α-helikalen RBD wechselwirkt.5 Aus den RBD verschiedener AKAP abgeleitete, synthetische Peptide binden die R-Untereinheiten mit Affinitäten im nanomolaren Bereich, z. B. AKAP18δ-L314E aus AKAP18δ (KD=4 nM; Abbildung S1 und S2 sowie Tabelle S2 in den Hintergrundinformationen).6 Diese Peptide hemmen effektiv AKAP-PKA-Wechselwirkungen.1 In kultivierten renalen Hauptzellen verhindern z. B. membrangängige Varianten, von AKAP18δ-L314E7 und Ht312a (aus AKAP-Lbc) die AVP-induzierte Umverteilung von AQP2. Die Hemmung von AKAP-PKA-Wechselwirkungen könnte somit vorteilhaft für die Behandlung von Krankheiten sein, die mit AVP-abhängigen, exzessiven Wassereinlagerungen assoziiert sind, z. B. die Herzinsuffizienz.3 Aufgrund ihrer allgemein geringen Membrangängigkeit und Stabilität sind Peptide für eine Anwendung in Zell- und Tierstudien und für die Entwicklung von Medikamenten nur begrenzt einsetzbar. Alternativ zu Peptiden kommen nichtpeptidische Helixmimetika in Betracht. So wurde eine niedermolekulare Verbindung (FMP-API-1) entwickelt, die AKAP-PKA-Wechselwirkungen hemmt. Allerdings aktiviert FMP-API-1 zusätzlich die PKA. Das führt bei Studien an komplexen Systemen wie einem Tiermodell mit großer Wahrscheinlichkeit zu unerwünschten Effekten.8 Nichtpeptidische Helixmimetika, einschließlich Terphenyl- und Terpyridingerüste,9 imitieren α-Helices, indem sie eine stabförmige Achse mit von Aminosäuren abgeleiteten Seitenketten bereitstellen. Sie können Eigenschaften von Peptiden, wie Spezifität und Selektivität, mit denen von niedermolekularen Substanzen, wie Stabilität und Membrangängigkeit, vereinen. In Hinblick auf die Löslichkeit, die Konformation und die biologische Aktivität dieser Klasse entwickelten wir Polypyridine als Helixmimetika des Peptids AKAP18δ-L314E.10 Ausgangspunkt war ein Modell, bei dem zum einen die hydrophoben Reste (L301, L304, L308) des Peptids mit dem hydrophoben Boden der Tasche des D/D-Domänen-Dimers von RIIα und zum anderen die hydrophilen Seitenketten des Peptids, wie E300, mit hydrophilen Resten, wie Q4 am peripheren Rand der durch das D/D-Dimer gebildeten Tasche, wechselwirken.6 Verschiedene Terpyridine, 1 a–f (Schema 1 und 4), wurden in silico durch Docking-Studien entworfen. Der hydrophobe Bereich der AKAP18δ-L314E-Helix entspricht der meta-Methylgruppe des zweiten Pyridins, dem kondensierten Cyclopentylring des dritten Pyridins und den folgenden zwei Benzylringen in 1 b. Damit können sie mit dem hydrophoben Kern (gelb in Abbildung 4 und Abbildung S1) der Bindungstasche wechselwirken. Andere Substituenten, wie die Carboxygruppe am ersten äußersten Pyridinring, wenden sich den hydrophilen Resten am Rand der D/D-Domäne zu. Sie imitiert die Seitenkette von E300 und wechselwirkt wahrscheinlich mit Q4 der D/D-Domäne. Geplante Synthese von Terpyridinen 1 a–f durch aufeinanderfolgende Suzuki-Kupplungen. Für die Synthese der Liganden 1 a–f sind aufeinanderfolgende Suzuki-Kupplungen der 2,5-Dibrompyridine 3 a,b notwendig (Schema 1). Der Schlüssel dieser Strategie war die unterschiedliche Reaktivität der 2-Brom- und 5-Brom-Substituenten, die regioselektive Suzuki-Kupplungen von 3 a,b ermöglichte.11 Die Synthese des ersten Pyridylbausteins, Diisopropylboronsäureester 2, basiert auf einer ortho-Borylierung des Cyanpyridins 5. Eine ortho-Metallierung (DoM) nutzt diese Cyanfunktion, die mit dem ersten Äquivalent des LiTMP als Base reagiert und wahrscheinlich ein Li-Amidinat bildet, das als Donor-Metallierungs-Gruppe (DMG) dient und die Deprotonierung an C3 des Pyridinrings mit dem zweiten Äquivalent der Base lenkt.12 Für eine effiziente Metallierung war ein drittes Äquivalent der Base nötig, um voraussichtlich den aliphatischen Ester in ein Enolat umzuwandeln, damit die benachbarte Benzylposition vor einer Deprotonierung geschützt ist. Die Zugabe von vier Äquivalenten der Base erhöhte die Ausbeute ohne weitere Nebenreaktion. Da eine Isolierung des Diisopropylboronsäureesters nicht möglich war und die Isolierung von Boronsäure mit Protodeboronierung verbunden ist, haben wir die Säure durch Zugabe von Pinakol zum Reaktionsgemisch in situ verestert.13 Die Synthese des Esters 2 erfordert die Zugabe von Pinakol und das Erwärmen des Reaktionsgemisches auf 40 °C (Schema 2). Synthese der Bipyridinbromide 6 a,b, Bausteine für die abschließende Kupplungsreaktion. Die Pd-katalysierte Kupplung der 2,5-Dibrom-3-methylpyridine 3 a,b mit dem ungereinigten Boronsäureester 2 erfolgte in Gegenwart von Kaliumphosphat und ergab geringe Mengen der Bipyridine 6 a,b. Durch tropfenweises Zugeben des Boronsäureesters 2 über 90 Minuten konnte die Ausbeute auf 74 % erhöht werden (Schema 2). Die Cyclopentapyridinreste der Bausteine 4 a,b wurden in einer RhII-katalysierten [2+2+2]-Cycloaddition von 1,6-Heptadiin (7) mit Bernsteinsäuredinitril (8) synthetisiert (Schema 3).14 Die Reduktion der Nitrilgruppe mit Dimethylsulfid-Boran führte zum Amin 10. Das monobenzylierte Amin 10-Bn wurde durch reduktive Aminierung und anschließende Dibenzylierung mit Et3N als Base gewonnen. Für die regioselektive Halogenierung an C1 des Cyclopentapyridins 11 a wurde ein Lithiumbasengemisch eingesetzt.15 Bei der Lithiierung mit n-Hexan als Lösungsmittel15 wurde kein Ausgangsmaterial umgesetzt. Nur unter Zugabe von Diethylether als zusätzliches Lösungsmittel während des Metallierungsprozesses bildeten sich 4 a,b. CBr4 und C2Cl6 wurden als Elektrophile verwendet. Da sich die Chlorierung als effizienter erwies, wurden die abschließenden Kupplungsreaktionen mit den Chlorpyridinen 4 a,b optimiert. Synthese der Cyclopentapyridylchloride 4 a,b. Die Synthese von Cyclopentapyridin 11 b, mit zwei unterschiedlichen Benzylresten, erforderte eine getrennte Einführung dieser Gruppen. Das sekundäre Amin wurde unter stärkeren, basischen Bedingungen mit NaOH erhalten, wobei die substituierte Benzylgruppe in einer mikrowellenunterstützten wässrigen N-Alkylierung eingeführt wurde.16 Für die Lithiierung von Pyridin 4 a waren überraschenderweise die verwendeten vier Äquivalente Li-Base nicht ausreichend (59 % Ausbeute); eine Vervierfachung der Menge an Base erhöhte die Ausbeute an 4 b auf 78 %. Für die Synthese der Terpyridine 12 a,b entwickelten wir ein mikrowellenunterstütztes “Eintopf”-Verfahren der Suzuki–Miyaura-Kupplung. Für diese Borylierungs- und C-C-Kupplungsreaktionen wurden Lösungsmittel, Reaktionstemperatur, Pd0-Katalysator und Phosphinligand optimiert (Tabelle S1). Die höchsten Ausbeuten (12 a=46 %, 12 b=50 %) ergab die Kombination von [Pd2(dba)3] als Pd0-Quelle mit XPhos als Ligand im Lösungsmittel Dioxan. Der Einsatz von wässrigem Kaliumphosphat als Base war effektiver als Kaliumcarbonat. Der Borylierungsschritt zeigte, unter Verwendung von KOAc als Base, eine vollständige Umsetzung des Ausgangsmaterials, die Kreuzkupplung erforderte jedoch die Zugabe einer stärkeren Base.15 Die letzte Stufe der Synthese war eine Hydrolyse der 2-Cyanterpyridine 12 a,b. Basenkatalyse führte nur zu einer Teilhydrolyse der Nitrilfunktion (Schema 4, Bedingungen a). Die Amidoterpyridylpropionsäuren 1 a und 1 c wurden jeweils aus den Ethylestern 12 a und 12 b erhalten. Cyanterpyridylpropionsäure 1 e entstand bei auf eine Stunde reduzierter Hydrolysezeit (Schema 4, Bedingungen c). Die säurekatalysierte Hydrolyse (Schema 4, Bedingungen b) lieferte die erwarteten Dicarbonsäuren 1 b und 1 d. Synthese der Terpyridine 12 a–c durch Suzuki-Miyaura-Kupplung in einem mikrowellenunterstützten “Eintopf”-Verfahren und ihre base- oder säurekatalysierte Hydrolyse zu den Terpyridylpropionsäuren 1 a–f. Reagentien und Bedingungen: a) NaOH, EtOH/H2O, 85 °C, 4 h; b) 6 m HCl, EtOH, 95 °C, 1 h; c) NaOH, EtOH/H2O, 85 °C, 1 h. In 15N-SOFAST-HMQC-Experimenten wurde untersucht, ob die neuen Verbindungen an die D/D-Domäne binden.17 1 a–f verursachen ähnliche Verschiebungen oder das Verschwinden von Signalen wie die aus AKAP18δ abgeleiteten Peptide. Daher binden sie wahrscheinlich an gleicher Stelle an die D/D-Domäne (siehe die Hintergrundinformationen). Messungen mit isothermer Titrationskalorimetrie ergaben, dass 1 b und 1 f die D/D-Domäne mit KD-Werten von etwa 148 μM bzw. 31 μM binden (Abbildung 1). Die Bindung ist hauptsächlich durch eine große positive Entropieänderung gekennzeichnet, die vermutlich auf der Verdrängung von Wassermolekülen an der Bindungsstelle beruht. 1 d bindet die D/D mit einem KD-Wert ähnlich dem von 1 f (10–60 μM). Allerdings waren die kalorimetrischen Daten aufgrund der geringeren Enthalpieänderung bei dieser Bindung von minderer Qualität (Abbildung S4). Isotherme Titrationskalorimetrie-Messungen zur Bestimmung der KD-Werte der Bindung der Substanzen 1 b und 1 f an die D/D-Domäne von RIIα. Die Messungen erfolgten in einem MicroCal-VP-ITC-Gerät durch wiederholte Injektion von 10 μL D/D-Domäne in eine niedriger konzentrierte Substanzlösung; mit 1.0 mM D/D-Domäne und 0.05 mM 1 b bzw. 0.6 mM D/D-Domäne und 0.03 mM 1 f. Die Daten wurden auf ein Modell mit einseitiger Bindung angepasst. Quantitativ wurde der Einfluss unserer Verbindungen auf AKAP-PKA-Wechselwirkungen mit HTRF (homogeneous time-resolved fluorescence) bestimmt. Die HTRF-Messungen mit der D/D-Domäne von RIIα und AKAP18α (bei pH 7) ergaben, dass 1 b und 1 e das FRET-Signal reduzieren und somit diese Wechselwirkung inhibieren (IC50=38 μM bzw. 138 μM; Abbildung 2). Wie zu erwarten war, hemmt das Peptid AKAP18δ-L314E die Wechselwirkung im nanomolaren Konzentrationsbereich (12.7 nM),6 und das inaktive Kontrollpeptid AKAP18δ-PP hat keinen Einfluss auf die Wechselwirkung (Abbildung 2). Eine hemmende Wirkung von 1 a und 1 f war zu gering, um IC50-Werte zu bestimmen. Die Verbindungen 1 b und 1 e und das Peptid AKAP18δ-L314E hemmen die Wechselwirkung der D/D-Domäne von RIIα mit AKAP18α. Die N-terminalen 10 Aminosäuren von AKAP18α, die die Membranbindestelle umfassen, wurden deletiert. Das Peptid AKAP18δ-PP entspricht der RII-Bindungsdomäne von AKAP18δ, enthält aber zwei Proline, die eine Wechselwirkung mit der D/D-Domäne verhindern. Dieses Peptid hatte keinen Einfluss auf die Wechselwirkung.6 Für die HTRF-Analysen wurden Proteinkonzentrationen von je 50 nM eingesetzt. Daraufhin untersuchten wir den Einfluss von 1 b auf AKAP-PKA-Wechselwirkungen in Zellen. HEK293-Zellen verfügen über einen negativen Rückkopplungsmechanismus, um die durch Prostaglandin E1 (PGE1) induzierte cAMP-Synthese zu unterdrücken. Dieser Mechanismus hängt von AKAP-PKA-Wechselwirkungen ab. Die Stimulation der Zellen mit PGE1 führt zur Aktivierung der Adenylylcyclase und einer Synthese von cAMP. Das cAMP aktiviert die PKA. Diese phosphoryliert die cAMP-Phosphodiesterase PDE4D und erhöht dadurch die PDE-Aktivität, welche die cAMP-Akkumulation hemmt. PDE4D wird durch die an Gravin (AKAP250) gebundene PKA phosphoryliert.18 Darüber hinaus verankert AKAP150 die PKA an der Adenylylcyclase und erleichtert so die Phosphorylierung der Cyclase. Ihre Phosphorylierung durch PKA hat ihre Inaktivierung zur Folge.19 Die Unterbrechung von AKAP-PKA-Wechselwirkungen durch Peptide (Ht31) oder das kleine Molekül FMP-API-1 und die PKA-Hemmung mit H89 verhindert die PGE1-abhängige, negative Rückkopplung und erhält eine hohe Adenylylcyclaseaktivität in Gegenwart von PGE1 aufrecht.8, 18, 19 1 b hemmt diese Rückkopplung ebenfalls. Das spricht für eine Hemmung von AKAP-PKA-Wechselwirkungen in Zellen (Abbildung 3). Obwohl 1 a an die D/D-Domäne bindet (Abbildung S3), hemmt es die Rückkopplung nicht. Vermutlich gelangt es nicht in ausreichender Konzentration in die Zellen. Die Terpyridine hemmen auch nicht die katalytische Aktivität der PKA. HEK293-Zellen, die cAMP-abhängige Ionenkanäle, “cyclic nucleotide-gated channels” (CNGC), transient exprimieren, wurden mit dem Ca2+-Indikator Fura-2 beladen. Die Zellen wurden mit dem PKA-Hemmstoff H89, mit FMP-API-1 1 a oder 1 b (jeweils 20 μm, 30 min) inkubiert oder blieben unbehandelt. Die Zellen wurden zum Zeitpunkt 60 Sekunden mit Prostaglandin E1 (PGE1) stimuliert, um die cAMP-Synthese auszulösen. cAMP öffnet die CNGCs, Ca2+ gelangt in die Zellen und bindet an Fura-2. Die durch die Bindung erzeugten Fluoreszenzsignale wurden gemessen. In Klammern steht die Anzahl der jeweils gemessenen Zellen. Wir haben eine Reihe von Terpyridinen als α-Helixmimetika des Peptids AKAP18δ-L314E entwickelt, das die PKA-Bindung an AKAP unterbricht. Die Substanzen binden die D/D-Domäne der RII-Untereinheiten ähnlich wie das ursprüngliche Peptid. Eine der Verbindungen, 1 b, ist der erste nichtpeptidische Wirkstoff, der die D/D-Domäne der RII-Untereinheiten bindet und die AKAP-PKA-Wechselwirkung sowohl in vitro als auch in vivo hemmt. Das Modell der Wechselwirkung ist in Abbildung 4 dargestellt. Die Auswertung von Struktur-Aktivitäts-Beziehungen (SAR) zeigt, dass R2=COOH in der Verbindung 1 b maßgeblich zur Hemmung beiträgt. NH2, wie bei 1 a, wird an dieser Stelle nicht toleriert. Da 1 b und 1 e die AKAP-PKA-Wechselwirkungen hemmen, wird sowohl H als auch R1=OMe toleriert (Abbildung 2). Der Einfluss von R2=CN bei Verbindung 1 e wird nicht deutlich. Der COOH-Rest als R2 ermöglicht die Synthese weiterer Derivate und bildet damit eine Grundlage für neue hoch affine Verbindungen, die AKAP-PKA-Wechselwirkungen hemmen können. Diese SAR-Daten zusammen mit unseren NMR-Daten bestätigen das Wechselwirkungsmodell von 1 b und der D/D-Domäne der RIIα-Untereinheiten (Abbildung 4), in dem 1 b die Konformation der α-Helix des AKAP18δ-Fragments imitiert und mit der D/D-Domäne wechselwirkt (Abbildung S1). Modell der Wechselwirkung des Terpyridins 1 b (cyan) mit der D/D-Domäne der humanen, regulatorischen RIIα-Untereinheiten der PKA. Die Primärstruktur der D/D-Domäne ist SHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREAR (Genbank-Eintrag NP_004148); die Aminosäurereste der Tasche sind als Seitenketten mit durchsichtiger Oberfläche dargestellt (gelb: hydrophob, blau: hydrophil). Die Bindungstasche ist überwiegend hydrophob (I5, P6, L9, T10, L13, T17, L21). Am Rand enthält die Tasche die H-Brücken-Donoren Q4, Q14 (blau), die mit den Carboxygruppen am Terpyridinrest von 1 b wechselwirken können. Details siehe die Hintergrundinformation. Zusammenfassend stellen die neuen Terpyridingerüste die ersten biologisch aktiven und nichtpeptidischen Verbindungen dar, die die Bindungsstelle der AKAP an regulatorischen RII-Untereinheiten der PKA blockieren und somit AKAP-PKA-Wechselwirkungen hemmen können. As a service to our authors and readers, this journal provides supporting information supplied by the authors. Such materials are peer reviewed and may be re-organized for online delivery, but are not copy-edited or typeset. Technical support issues arising from supporting information (other than missing files) should be addressed to the authors. Please note: The publisher is not responsible for the content or functionality of any supporting information supplied by the authors. Any queries (other than missing content) should be directed to the corresponding author for the article.